Share this post on:

Name :
ALG1 (Human) Recombinant Protein (Q01)

Biological Activity :
Human ALG1 partial ORF ( NP_061982, 154 a.a. – 253 a.a.) recombinant protein with GST-tag at N-terminal.

Tag :
Best use within three months from the date of receipt of this protein.

Protein Accession No. :
NP_061982

Protein Accession No.URL :
https://www.ncbi.nlm.nih.gov/gene?cmd=Retrieve&dopt=Graphics&list_uids=56052

Amino Acid Sequence :
IDWHNYGYSIMGLVHGPNHPLVLLAKWYEKFFGRLSHLNLCVTNAMREDLADNWHIRAVTVYDKPASFFKETPLDLQHRLFMKLGSMHSPFRARSEPEDP

Molecular Weight :
36.74

Storage and Stability :
Store at -80°C. Aliquot to avoid repeated freezing and thawing.

Host :
Wheat Germ (in vitro)

Interspecies Antigen Sequence :
Mouse (80)

Preparation Method :
in vitro wheat germ expression system

Purification :
Glutathione Sepharose 4 Fast Flow

Quality Control Testing :
12.5% SDS-PAGE Stained with Coomassie Blue.

Storage Buffer :
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Applications :
Enzyme-linked Immunoabsorbent Assay, Western Blot (Recombinant protein), Antibody Production, Protein Array,

Gene Name :
ALG1

Gene Alias :
HMAT1, HMT-1, HMT1

Gene Description :
asparagine-linked glycosylation 1, beta-1,4-mannosyltransferase homolog (S. cerevisiae)

Gene Summary :
The enzyme encoded by this gene catalyzes the first mannosylation step in the biosynthesis of lipid-linked oligosaccharides. This gene is mutated in congenital disorder of glycosylation type Ik. [provided by RefSeq

Other Designations :
GDP-Man:GlcNAc2-PP-dolichol mannosyltransferase|GDP-mannose-dolichol diphosphochitobiose mannosyltransferase|asparagine-linked glycosylation 1 homolog (yeast, beta-1,4-mannosyltransferase)|beta-1,4 mannosyltransferase|beta-1,4-mannosyltransferase|chitobio

MedChemExpress (MCE) recombinant proteins include: cytokines, enzymes, growth factors, hormones, receptors, transcription factors, antibody fragments, etc. They are often essential for supporting cell growth, stimulating cell signaling pathways, triggering or inhibiting cell differentiation; and are useful tools for elucidating protein structure and function, understanding disease onset and progression, and validating pharmaceutical targets. At MedChemExpress (MCE), we strive to provide products with only the highest quality. Protein identity, purity and biological activity are assured by our robust quality control and assurance procedures.
Related category websites: https://www.medchemexpress.com/recombinant-proteins.html
Popular product recommendations:
Coagulation Factor XI/F11 ProteinMolecular Weight
OX40 Ligand/TNFSF4 ProteinMolecular Weight
Popular categories:
Cathepsin E
Serine/Threonine Phosphatase

Share this post on: